<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25092
| Description |
GM10244 |
| Sequence | MASNESGGGNLMDEFEEAFQSCLLTLTKQEPNSGTNKEEIDLEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTPPIGAGMLQGPGGGMPPMGGTPPRPGMMPGMPPGAMQPGGPMQPSPQHMLQAQQMQQLRMMGRQMPPK |
| Length | 190 |
| Position | Head |
| Organism | Drosophila sechellia (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.665 |
| Instability index | 72.93 |
| Isoelectric point | 6.31 |
| Molecular weight | 21179.28 |
| Publications | PubMed=17994087
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
| Repeats |
>MDP25092
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.83| 16| 18| 122| 139| 1
---------------------------------------------------------------------------
133- 151 (31.79/12.24) PGGGMPPmggTPP.RPGMMP
154- 173 (25.04/ 7.93) PPGAMQPggpMQPsPQHMLQ
---------------------------------------------------------------------------
|