<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25075
| Description |
GM20436 |
| Sequence | MNMMPMSGPQMMQVMQSSPSGPPGPVQHQQQQAPQPLQQQQQAEKLDNISRVKSLLGPLRESMFLTIRSSAFTLQQNNLADNLKRDTGAHHVPRFDKHLEDFYACCDQIEIHLKTAMQCLQQQNSSNHYLPGPVTPMRMETFMPDNAGPISYPTYLNTVRVHIQSAKDIHDTLISAAQNISQAD |
| Length | 184 |
| Position | Tail |
| Organism | Drosophila sechellia (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.604 |
| Instability index | 75.25 |
| Isoelectric point | 6.42 |
| Molecular weight | 20694.31 |
| Publications | PubMed=17994087
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa
transcription factor binding GO:0008134 IEA:EnsemblMetazoa
|
| GO - Biological Process | genital disc sexually dimorphic development GO:0035263 IEA:EnsemblMetazoa
imaginal disc-derived female genitalia morphogenesis GO:0048804 IEA:EnsemblMetazoa
negative regulation of cell death GO:0060548 IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
sex determination GO:0007530 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
| Repeats |
>MDP25075
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.41| 17| 106| 10| 26| 1
---------------------------------------------------------------------------
10- 26 (34.88/15.84) QMMQVMQSSPSGPPGPV
118- 134 (34.54/15.63) QCLQQQNSSNHYLPGPV
---------------------------------------------------------------------------
|