<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25068
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSNQETQVSSLPMPPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYNNDEMIRSLESQNIKRLIPIHFDRRKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARETLRVMMEMQKRQRVETATRFQKHLERVREIVNTAFSALPVLDDDDDSGGAKIKTEVDPLEANAAAKNDPSYQHDRMLCKLVDAIE |
Length | 220 |
Position | Middle |
Organism | Drosophila sechellia (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.706 |
Instability index | 49.89 |
Isoelectric point | 6.26 |
Molecular weight | 25737.04 |
Publications | PubMed=17994087
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
Repeats |
>MDP25068
No repeats found
No repeats found
|