<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25066
Description |
GM25819 |
Sequence | MAGNFWQSSHSQQWILDKPDLLRERQHDLLALNEDEYQKVFIFFANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCLIVYQPYRPLLQLVQDMGQEDQLLTLSWRIVNDSLRTDVCLLYPPYQIAIACLQIACVILQKDATKQWFAELNVDLDKVQEIVRAIVNLYELWKDWKEKDEIQMLLSKIPKPKPPPQR |
Length | 267 |
Position | Kinase |
Organism | Drosophila sechellia (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.088 |
Instability index | 49.31 |
Isoelectric point | 5.99 |
Molecular weight | 31292.06 |
Publications | PubMed=17994087
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblMetazoa
transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa
|
GO - Biological Process | chaeta development GO:0022416 IEA:EnsemblMetazoa
imaginal disc-derived leg segmentation GO:0036011 IEA:EnsemblMetazoa
positive regulation of autophagy GO:0010508 IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
sex comb development GO:0045498 IEA:EnsemblMetazoa
snRNA 3'-end processing GO:0034472 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
Repeats |
>MDP25066
No repeats found
|