<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25039

Description GL12107
SequenceMAQNDPGSGNLMDEFEEAFQSCLLSLTKQEPNSGTNKEEIELEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHNRPTPPINPGMLQGPSGMQQPMGGGVPPRPGLMPGMPPGGMSPVGPMPPGQQHMLQAQQMQQLRMMGKLPPK
Length190
PositionHead
OrganismDrosophila persimilis (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora.
Aromaticity0.05
Grand average of hydropathy-0.668
Instability index74.94
Isoelectric point6.31
Molecular weight21308.44
Publications
PubMed=17994087

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25039
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     100.30|      19|      20|     123|     141|       1
---------------------------------------------------------------------------
  123-  141 (42.13/17.75)	PPINPGMLQG..PSGMQQPMG
  145-  163 (30.38/10.96)	PP.RPGLMPGmpPGGM.SPVG
  166-  183 (27.79/ 9.46)	PPGQQHMLQA..QQMQQLRM.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.19|      22|      31|      46|      67|       2
---------------------------------------------------------------------------
   46-   67 (37.20/29.02)	KTTNRFIDVARQMEAFFLQKRF
   79-  100 (35.99/27.87)	KDENQDLSIEIQRKEALLQKHY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.97|      20|      24|       1|      20|       3
---------------------------------------------------------------------------
    1-   20 (36.02/25.20)	MAQNDPGSGNLMDEFEEAFQ
   26-   45 (32.95/22.45)	LTKQEPNSGTNKEEIELEVQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25039 with Med28 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SDIQQGVHNRPTPPINPGMLQGPSGMQQPMGGGVPPRPGLMPGMPPGGMSPVGPMPPGQQHMLQAQQMQQLRMMGKLPPK
111
190










Molecular Recognition Features






MoRF SequenceStartStop




NANANA