<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25035
| Description |
GL11679 |
| Sequence | MGSQDKRLADELTTRLNKSITDVDTVMLNLDGKDFTVEPVCRRFALGAPHDKGPREELVYQMLYANLLHLYLKDYTDFFDQFQAMTGT |
| Length | 88 |
| Position | Tail |
| Organism | Drosophila persimilis (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.419 |
| Instability index | 23.86 |
| Isoelectric point | 4.94 |
| Molecular weight | 10134.41 |
| Publications | PubMed=17994087
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25035
No repeats found
No repeats found
|