<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25028
| Description |
GL23473 |
| Sequence | MASGSRITILPQSKEALLKSYNVRLKEDVRSMLENFEETLKLARRDSHSQISRTTQSEQDALEMQIRASNMVRAGESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRSTQIECDKKLMKLRDEMAMDLYDLEEEYYTSIFK |
| Length | 143 |
| Position | Head |
| Organism | Drosophila persimilis (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.550 |
| Instability index | 53.81 |
| Isoelectric point | 5.48 |
| Molecular weight | 16662.84 |
| Publications | PubMed=17994087
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25028
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.94| 19| 55| 49| 67| 1
---------------------------------------------------------------------------
49- 67 (32.93/23.01) SQISRTTQSEQDALEMQIR
105- 123 (34.01/23.97) SQLFRSTQIECDKKLMKLR
---------------------------------------------------------------------------
|