<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25021
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSDVENPGVGGKPPPYKDPDNGSQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPTNKELAHRQQYFFWKNYRNNRLKHIIPRPPPEPAPSQAPATLPLQASVPTPVAPPVPAPTSSMPPVVAGGASAMSPMQFVGTPGTNMPKNDMRNAMDNRKRKYAPPPLQSSNSHFMKLFVHALFSFLAILSVL |
| Length | 232 |
| Position | Middle |
| Organism | Zea mays (Maize) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.415 |
| Instability index | 56.35 |
| Isoelectric point | 9.45 |
| Molecular weight | 26438.24 |
| Publications | PubMed=19936069
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25021
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.58| 11| 27| 129| 155| 1
---------------------------------------------------------------------------
121- 134 (16.54/ 6.06) LKHIIPRP..ppePAP
143- 158 (16.03/20.39) LQASVPTPvappvPAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 90.07| 20| 27| 26| 45| 2
---------------------------------------------------------------------------
26- 45 (37.42/24.27) FLLEL....EFVQCLANPTYIHYL
56- 75 (36.68/23.66) FIGYL....KYLKYWQRPEYIKYI
82- 100 (15.98/ 6.48) FFLELlqnaNFRNAMAHPT.....
---------------------------------------------------------------------------
|