<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25017
Description |
Uncharacterized protein |
Sequence | MDPQFKKILQQKRQNVEDLFDFEGCKVGRGTYGHVYKAKMKTSGKEYALKLIEGTGISMSACREIAILREISHTHVISLQGVFLTHASRKVWLLLDFAEHDLWHIIKFHRPKGGKKSVPIDTKIVKSLLRQILDGIQYLHSNWILHRDLKPANILVMGDGLERGRVKIADMGFARHFWAPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDLKATTPYHHDQLDRIFTVMGFPHERDWEDIKIMPEYKRLQEDFKKPSYVNFASCSLAKYMDKFKIRHDSREFSLLQKFLIADPNKRISAELAMDDAYFREEPYPTDDVFDGKPIPYPKREFLHDDEHEEKHDKNKVRHCVFIFSPEIIQI |
Length | 387 |
Position | Kinase |
Organism | Trichoplax adhaerens (Trichoplax reptans) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.389 |
Instability index | 41.71 |
Isoelectric point | 8.35 |
Molecular weight | 45285.89 |
Publications | PubMed=18719581
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IBA:GO_Central
RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IBA:GO_Central
|
GO - Biological Process | protein phosphorylation GO:0006468 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP25017
No repeats found
|