<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25015
Description |
Predicted protein |
Sequence | MSENLIDQLEDNLKDCVNCIGKKLGEEDLKVVTDKFIECSQRVEDYFLKYGITQNKVKNITYGDVAQLKDELERKELLLKRNLDKLTEYQSTLDQLHQQDLTKWKE |
Length | 106 |
Position | Head |
Organism | Trichoplax adhaerens (Trichoplax reptans) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.814 |
Instability index | 39.22 |
Isoelectric point | 4.97 |
Molecular weight | 12526.10 |
Publications | PubMed=18719581
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP25015
No repeats found
No repeats found
|