Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MADNPLLSILDQIENLTRETLRKVNVNIRDTSNASKEIDLIANKDEEFRKALVDAQGKIEVYNKIRKCNEAVVQQDRVIVQLMDKLKQAESSLMSAIENAKEVLPCEESRSVNSEDLIKYAYEISSNHAVCAPTNWQQGDSRRPYPIDIEMRAGILGKLTEYNVNGDNAIDVDYGISNSNKNSEAVDDSNKQNENLSDQPSESDNEVENLENDQGINNNIGMMSTDSSSDS |
Length | 231 |
Position | Middle |
Organism | Trichoplax adhaerens (Trichoplax reptans) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.769 |
Instability index | 54.35 |
Isoelectric point | 4.41 |
Molecular weight | 25804.06 |
Publications | PubMed=18719581 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP25008 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 97.69| 29| 50| 97| 125| 2 --------------------------------------------------------------------------- 97- 125 (48.41/26.97) IENAKEVLPCEESRSVNSEDLIKYAYEIS 149- 177 (49.28/27.56) IEMRAGILGKLTEYNVNGDNAIDVDYGIS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EVENLENDQGINNNIGMMSTDS 2) YPIDIEMRA | 206 145 | 227 153 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab