| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MADNPLLSILDQIENLTRETLRKVNVNIRDTSNASKEIDLIANKDEEFRKALVDAQGKIEVYNKIRKCNEAVVQQDRVIVQLMDKLKQAESSLMSAIENAKEVLPCEESRSVNSEDLIKYAYEISSNHAVCAPTNWQQGDSRRPYPIDIEMRAGILGKLTEYNVNGDNAIDVDYGISNSNKNSEAVDDSNKQNENLSDQPSESDNEVENLENDQGINNNIGMMSTDSSSDS |
| Length | 231 |
| Position | Middle |
| Organism | Trichoplax adhaerens (Trichoplax reptans) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.769 |
| Instability index | 54.35 |
| Isoelectric point | 4.41 |
| Molecular weight | 25804.06 |
| Publications | PubMed=18719581 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP25008
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 97.69| 29| 50| 97| 125| 2
---------------------------------------------------------------------------
97- 125 (48.41/26.97) IENAKEVLPCEESRSVNSEDLIKYAYEIS
149- 177 (49.28/27.56) IEMRAGILGKLTEYNVNGDNAIDVDYGIS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EVENLENDQGINNNIGMMSTDS 2) YPIDIEMRA | 206 145 | 227 153 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab