<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25004
| Description |
Uncharacterized protein |
| Sequence | MAATEGCRIVKRICDESFNLFKWLHEADIGVYKESQYHLEQTETLKQKLDSIKALFRSLRLVYEDCNRNGKIDDQEIKELLFSDNNEAKSTQRDSDKDGLTMERQELEERIKEKNQQLKIVIDQLRETTNNSNSNMFIFHTSTCNVIILSHSDFLCSKSCND |
| Length | 162 |
| Position | Head |
| Organism | Trichoplax adhaerens (Trichoplax reptans) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.751 |
| Instability index | 31.10 |
| Isoelectric point | 5.32 |
| Molecular weight | 18946.08 |
| Publications | PubMed=18719581
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25004
No repeats found
No repeats found
|