<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25001
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVTIVGLCAIPPEKTSQQVIDVLVKRLTNLFADVVGVWSLDFEHYQANTDSLSSKNVVYSLAWSDNNTKYIMHNNDDGQIVPMESADEFTDNIKNYTLRKSLKAHGQTLLLGDFIVKLSSIVGGHTSLTDIVIEANYKPCSHVGVCWNLLHEFCKILTESYELSLPETPPLNILGDGTFDKSQTATQYADIFINHKKAVTKSL |
Length | 204 |
Position | Head |
Organism | Trichoplax adhaerens (Trichoplax reptans) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.085 |
Instability index | 30.75 |
Isoelectric point | 5.41 |
Molecular weight | 22650.51 |
Publications | PubMed=18719581
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP25001
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 170.43| 50| 108| 1| 52| 1
---------------------------------------------------------------------------
1- 52 (81.49/49.74) MGVTIVGLCAIPPEKTSqqVIDVLVKRLTNLFADVVGVWSLDFEHYQANTDS
112- 161 (88.95/49.14) LGDFIVKLSSIVGGHTS..LTDIVIEANYKPCSHVGVCWNLLHEFCKILTES
---------------------------------------------------------------------------
|