<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24997
| Description |
Uncharacterized protein |
| Sequence | MSPVGGEQQSRLQEINSKNYLRRVKDDVKSILDNFTSILSASKVKEESQLNGSAQSVMDRYEMHVRSSNITRAAESLVQLIDELKESLILDDFTSLNEANDAKRKQFEQYIQHSNSELQKIKHGIGQDLQQLETEYYNSAYK |
| Length | 142 |
| Position | Head |
| Organism | Trichoplax adhaerens (Trichoplax reptans) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.823 |
| Instability index | 67.81 |
| Isoelectric point | 5.41 |
| Molecular weight | 16301.91 |
| Publications | PubMed=18719581
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24997
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.57| 20| 55| 26| 45| 1
---------------------------------------------------------------------------
26- 45 (33.77/22.74) DDVKS..ILDNFTSILSASKVK
82- 103 (29.79/19.41) DELKEslILDDFTSLNEANDAK
---------------------------------------------------------------------------
|