Description | Uncharacterized protein |
Sequence | MSPVGGEQQSRLQEINSKNYLRRVKDDVKSILDNFTSILSASKVKEESQLNGSAQSVMDRYEMHVRSSNITRAAESLVQLIDELKESLILDDFTSLNEANDAKRKQFEQYIQHSNSELQKIKHGIGQDLQQLETEYYNSAYK |
Length | 142 |
Position | Head |
Organism | Trichoplax adhaerens (Trichoplax reptans) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.823 |
Instability index | 67.81 |
Isoelectric point | 5.41 |
Molecular weight | 16301.91 |
Publications | PubMed=18719581 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP24997 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.57| 20| 55| 26| 45| 1 --------------------------------------------------------------------------- 26- 45 (33.77/22.74) DDVKS..ILDNFTSILSASKVK 82- 103 (29.79/19.41) DELKEslILDDFTSLNEANDAK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AKRKQFEQYIQ 2) LETEYYNSAYK 3) LILDDF 4) QSVMDRYEMHVR | 102 132 88 55 | 112 142 93 66 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab