<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24990

Description Uncharacterized protein
SequenceMVKMKLHKRRFNGGGVEEYSAIEDGLGVALQCFDDMQAKYHKENGAIRDKFCILVCNSSPCGIPSSACYQYCGYSCERIAELIGSSIIEDLHVMPSQDYATSPHHLVLLKGFKLATKERSEPKTTVEPKPQPVVTNGTKEHRTVNDATANTRNFIPPSTSINSPPKNTPVVVTAASETIMPPVRPSVTNAVPMVAPVSLVTPPQTAFNPTPRDIPPVKVANRDKPNSNEAIPEIRKDNTSRSYPHTNPSTTKASLEITNRFPNTNPTVPPNVRHPQPNVNVQRHLIWSGLLSWERHNNKVDRRSGETLSVNGYAYSNENIRGEDWPRQLILRFVPGNLLAEMMPLLRKSIQILFHISMTDNNTKNLIQTLTQNKVVAFISFQGISLNPEEKLRLLILTYNPKKNFTGYIPRDQMDFVQKFQVVMKKSRETQKQKQQMQSGGYPPHSVGQPQMYVNQQQQQPQPQQSLLQSHSMKTPVGAQQLSSLSTSQSGPITSTKNSMVNMTRSSNFELGANSLHLNQQRQGNTMQQQQQSQVRNFLNQQQQSNVTQPPQQQLLNQQQQQQQQQQQRQSMSHQHNWALQQRLQRMQSAQNQSQQLANTLNSAQNRAPSEDWYP
Length615
PositionUnknown
OrganismTrichoplax adhaerens (Trichoplax reptans)
KingdomMetazoa
LineageEukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax.
Aromaticity0.06
Grand average of hydropathy-0.784
Instability index60.54
Isoelectric point9.70
Molecular weight69441.59
Publications
PubMed=18719581

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
transcription regulator complex	GO:0005667	IBA:GO_Central

GO - Biological Function
GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP24990
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     154.02|      36|      37|     122|     157|       1
---------------------------------------------------------------------------
  122-  141 (24.21/ 7.08)	......................PKTTV....E..PKPQ..PVVTNGTKEH
  142-  178 (38.90/15.52)	RTVNDATANTRNFIPP...........stsiNspPKNT..PVVVTAASET
  181-  224 (48.05/20.77)	PPVRPSVTNAVPMVAPvslvtpPQTAF....N..PTPRdiPPVKVANRDK
  225-  256 (42.86/17.79)	PNSNEAIPEIRK...D......NTSRS....Y..PHTN..PSTTKASLE.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.79|      15|      20|     514|     532|       2
---------------------------------------------------------------------------
  449-  470 (18.75/ 6.39)	QPQMYVNQQQQQpqpqqslLQS
  521-  541 (23.03/ 6.58)	QRQGNTMQQQQQ.sqvrnfLNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.79|      19|     130|     421|     439|       3
---------------------------------------------------------------------------
  421-  439 (32.15/17.19)	QVVMKKSRETQKQKQQMQS
  553-  571 (32.64/17.57)	QQLLNQQQQQQQQQQQRQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.10|      15|      15|     476|     490|       5
---------------------------------------------------------------------------
  476-  490 (24.20/13.52)	PVGAQQLSSLSTSQS
  492-  506 (22.90/12.39)	PITSTKNSMVNMTRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.29|      22|      63|     323|     344|       6
---------------------------------------------------------------------------
  323-  388 (23.43/13.59)	EDWPRQLILRFVPGNLLAEMMP
  389-  410 (38.86/27.40)	EEKLRLLILTYNPKKNFTGYIP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24990 with Med25 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) ERSEPKTTVEPKPQPVVTNGTKEHRTVNDATANTRNFIPPSTSINSPPKNTPVVVTAASETIMPPVRPSVTNAVPMVAPVSLVTPPQTAFNPTPRDIPPVKVANRDKPNSNEAIPEIRKDNTSRSYPHTNPSTTKASLEITNRFPNTNPTVPPNVRHPQPNV
2) SRETQKQKQQMQSGGYPPHSVGQPQMYVNQQQQQPQPQQSLLQSHSMKTPVGAQQLSSLSTSQSGPITSTKNSMVNMTRSSNFELGANSLHLNQQRQGNTMQQQQQSQVRNFLNQQQQSNVTQPPQQQLLNQQQQQQQQQQQRQSMSHQHNWALQQRLQRMQSAQNQSQQLANTLNSAQNRAPSEDWYP
118
427
279
615










Molecular Recognition Features






MoRF SequenceStartStop




NANANA