Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MLCSLLFKLSEWRVEAKDNNDDSIQRKRFLVELEFVQALANPQYLNFLAQHGYLRDSAFINYLDYLQYWKQQEYVKFVKYPQCLHFLDLLQSEHFRRELINNPCAKFIEEQQLLHWQYNTQSKIKAVVEAARQIKQGTIPLT |
Length | 142 |
Position | Middle |
Organism | Trichoplax adhaerens (Trichoplax reptans) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Placozoa> Trichoplacidae> Trichoplax. |
Aromaticity | 0.14 |
Grand average of hydropathy | -0.418 |
Instability index | 39.05 |
Isoelectric point | 7.71 |
Molecular weight | 17104.43 |
Publications | PubMed=18719581 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP24989 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 63.54| 16| 19| 44| 62| 1 --------------------------------------------------------------------------- 44- 55 (16.60/ 6.65) ......YLNF..LAQHGYLR 59- 76 (26.18/20.96) FINYldYLQY..WKQQEYVK 77- 96 (20.76/ 6.81) FVKYpqCLHFldLLQSEHFR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IQRKRFLVE 2) MLCSLLFKLSEWRVEAK | 24 1 | 32 17 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab