Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MASRQMANDHLRLSWHDTQMMATLSPQTVMDYFCRRSNPFYEHICNNETIRMQRLGPEHLHNMIGLEYILLHVAEPILYVIRKQHRHNPSEATPIADYYIIGGTVYKAPDLANVINARILNTVVNLQSAFEEASGYARYHPNKGYTWDFSSNKVLSDKSKSDKKDTSSSKDENSGTLFQKQRVDMLLAELLRKFPPPIPPMLQNLQQAPPTGDEMSSAGGLNSNEMNNATGPLDIKTEGVDMKPPPEKKSK |
Length | 251 |
Position | Head |
Organism | Drosophila ananassae (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.647 |
Instability index | 49.74 |
Isoelectric point | 7.13 |
Molecular weight | 28401.95 |
Publications | PubMed=17994087 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | cytoplasm GO:0005737 IEA:EnsemblMetazoa mediator complex GO:0016592 IEA:EnsemblMetazoa |
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblMetazoa |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa |
Binary Interactions |
Repeats | >MDP24982 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 92.94| 29| 54| 157| 185| 1 --------------------------------------------------------------------------- 157- 185 (47.83/30.33) DKSKSDKKDTSSSKDENSGTL.FQKQRVDM 213- 242 (45.11/28.25) DEMSSAGGLNSNEMNNATGPLdIKTEGVDM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KTEGVDMK 2) MLLAELLRKF | 236 185 | 243 194 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab