<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24979
Description |
Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MQRDEKLFELTLDAVLQRLNDLKLAVLSMIQKLEMEYETINWPTFLDNFAIISSHLTGLTKILAKEQCPPLRNRTVLPLMVSMDRDDTLINITEGRVPVFSHDIVPDYLRTRPDPITEQKMQQNEQKAANLTNDAAMKQVTQYNKVVSHVLDMVSKAREEWEIESSSRTGIQQTSSMADTQLLVAAVGMGKGLKLTNYGPGMMVPPSIRAPSPMGGPGMSPGNVQQQQLGKAPSAVKTNIKSANQVHPFSR |
Length | 251 |
Position | Head |
Organism | Drosophila ananassae (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.357 |
Instability index | 39.58 |
Isoelectric point | 7.83 |
Molecular weight | 27928.91 |
Publications | PubMed=17994087
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
Repeats |
>MDP24979
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.31| 10| 14| 199| 209| 1
---------------------------------------------------------------------------
199- 209 (16.99/14.39) GPGmMVPPSIR
216- 225 (21.32/12.30) GPG.MSPGNVQ
---------------------------------------------------------------------------
|