<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24961
Description |
Uncharacterized protein |
Sequence | MSGEDWRCPAFRENIICKLHFWSPYKGPEKISWAKALENHLFRRSRSSEEYLNLFSKVLDHYKSLAGKSGGSLPNTQCMETDLLAALENMNIEGTANPNPHMF |
Length | 103 |
Position | Tail |
Organism | Drosophila ananassae (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.574 |
Instability index | 60.91 |
Isoelectric point | 6.89 |
Molecular weight | 11804.30 |
Publications | PubMed=17994087
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-KW
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24961
No repeats found
No repeats found
|