<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24959

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMAKMYGKGKTAIESEEQQRRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLLENVNAAQQQQQQLQQQQQQSNGGEAATGGEATAATPNGNGNAAIASEGQAATTASQTAQNQAGNTQQQPQVNGLGTGSNMKLELN
Length205
PositionMiddle
OrganismDrosophila ananassae (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora.
Aromaticity0.11
Grand average of hydropathy-0.786
Instability index55.49
Isoelectric point7.62
Molecular weight23482.98
Publications
PubMed=17994087
PubMed=18057021

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364129
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblMetazoa
GO - Biological Function
transcription coactivator activity	GO:0003713	IEA:EnsemblMetazoa
GO - Biological Process
anterior/posterior axis specification, embryo	GO:0008595	IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II	GO:0006357	IEA:EnsemblMetazoa

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP24959
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      65.81|      15|      18|      67|      81|       2
---------------------------------------------------------------------------
   37-   60 (16.35/ 8.10)	YLNF...LAqrgffkdqsFINYLKYLQ
   67-   81 (27.84/18.19)	YAKY...LM.........YPMCLYFLD
   85-  102 (21.62/12.73)	YEHFrreIV.........NSQCCKFID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.80|      15|      49|     125|     139|       3
---------------------------------------------------------------------------
  125-  139 (27.37/12.86)	AAQQQQQQL..QQQQQQ
  174-  190 (22.43/ 9.24)	ASQTAQNQAgnTQQQPQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24959 with Med31 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QQQQQLQQQQQQSNGGEAATGGEATAATPNGNGNAAIASEGQAATTASQTAQNQAGNTQQQPQVNGLGTGSNMKLELN
128
205










Molecular Recognition Features






MoRF SequenceStartStop




1) AIASEG
163
168