<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24959
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAKMYGKGKTAIESEEQQRRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLLENVNAAQQQQQQLQQQQQQSNGGEAATGGEATAATPNGNGNAAIASEGQAATTASQTAQNQAGNTQQQPQVNGLGTGSNMKLELN |
| Length | 205 |
| Position | Middle |
| Organism | Drosophila ananassae (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.786 |
| Instability index | 55.49 |
| Isoelectric point | 7.62 |
| Molecular weight | 23482.98 |
| Publications | PubMed=17994087
PubMed=18057021
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblMetazoa
|
| GO - Biological Process | anterior/posterior axis specification, embryo GO:0008595 IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
| Repeats |
>MDP24959
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 65.81| 15| 18| 67| 81| 2
---------------------------------------------------------------------------
37- 60 (16.35/ 8.10) YLNF...LAqrgffkdqsFINYLKYLQ
67- 81 (27.84/18.19) YAKY...LM.........YPMCLYFLD
85- 102 (21.62/12.73) YEHFrreIV.........NSQCCKFID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.80| 15| 49| 125| 139| 3
---------------------------------------------------------------------------
125- 139 (27.37/12.86) AAQQQQQQL..QQQQQQ
174- 190 (22.43/ 9.24) ASQTAQNQAgnTQQQPQ
---------------------------------------------------------------------------
|