<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24955
| Description |
Uncharacterized protein |
| Sequence | MASNEPGGGNLMDEFEEAFQSCLLSLTKQEPNSGTNKEEIELDVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTPPIGSGMLQGAGGMPPMGGVPPRPGMMPGMGPGAGGMPPIGAMQPSPQHMLQAQQMQQLRMMGKLPPK |
| Length | 190 |
| Position | Head |
| Organism | Drosophila ananassae (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.550 |
| Instability index | 72.18 |
| Isoelectric point | 6.31 |
| Molecular weight | 21005.14 |
| Publications | PubMed=17994087
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
| Repeats |
>MDP24955
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.39| 20| 22| 128| 149| 1
---------------------------------------------------------------------------
128- 147 (46.10/19.52) GMLQGAGGMPPMGGVPPRPG
151- 170 (42.29/13.05) GMGPGAGGMPPIGAMQPSPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.19| 22| 30| 46| 67| 2
---------------------------------------------------------------------------
46- 67 (37.20/28.41) KTTNRFIDVARQMEAFFLQKRF
79- 100 (35.99/27.29) KDENQDLSIEIQRKEALLQKHY
---------------------------------------------------------------------------
|