<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24952
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDDVLNTQFARVEKALTTLVDSIAAYNPAPQAAIDLFTADDELSEGLDQLAKHQANHVRIQLLRAEADALEEQLKNSVKKLAELRHDLFNTPVTTFPQDSRAVPFDELLQYATNISRYTVPPTYREPVPVPDKDKEEEDVASSSLPTNGLNTPAIVPETTDPANDGLQAQKEGGDADAPAPEVTPEEEEWLKKLKASNLPWYPWPNNDRIRAGNLYSLQYWREKGKDLDTFNIPAYMEEERLKALGQNVESKASPAKEPEEHRDRGAPRPAIKLGVFTGLDDMED |
| Length | 285 |
| Position | Middle |
| Organism | Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae>
Pyrenophora.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.743 |
| Instability index | 50.44 |
| Isoelectric point | 4.58 |
| Molecular weight | 31843.95 |
| Publications | PubMed=23316438
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24952
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.60| 17| 23| 139| 160| 1
---------------------------------------------------------------------------
127- 147 (24.47/ 6.83) PVPVPdkdkEEEDVASSSLPT
153- 169 (31.13/22.37) PAIVP....ETTDPANDGLQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 135.07| 43| 106| 66| 111| 2
---------------------------------------------------------------------------
66- 111 (64.33/46.98) EADA.LEEQLKNSVKKLAELRHDlfNTPVTTFPQDSRaVPFDEL..LQY
175- 220 (70.74/41.43) DADApAPEVTPEEEEWLKKLKAS..NLPWYPWPNNDR.IRAGNLysLQY
---------------------------------------------------------------------------
|