Description | Uncharacterized protein |
Sequence | MKYSGLYFISNPSTNIDASLSIVNTLIQSIESSFQSATRQAPWSLSYRAFRDTIPPGYQHPTGADGKPKPYAHSYQHLLHLSNLDSNRTYIYAQPATQPETVVSIPLRQQDAYGSIGELRATREGPQSASVLSPGIVVCITTTVGAEDTDDGPDSGHASVGNETTMQVDGDDDEIDFEYAQTVIREFWSKIKDGRDLGRSEVREVMMAPVAPRKKAQERDAAVRRV |
Length | 226 |
Position | Head |
Organism | Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Pyrenophora. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.546 |
Instability index | 37.45 |
Isoelectric point | 5.23 |
Molecular weight | 24880.28 |
Publications | PubMed=23316438 |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP24950 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 64.50| 21| 21| 150| 170| 1 --------------------------------------------------------------------------- 150- 170 (39.07/22.03) DDGPDSGHA.SVGNETTMQV.DG 172- 194 (25.43/12.32) DDEIDFEYAqTVIREFWSKIkDG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MKYSGLYFI 2) RDAAVR 3) RTYIYA 4) SYRAFRDTIPPGYQH | 1 219 88 46 | 9 224 93 60 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab