| Description | Uncharacterized protein |
| Sequence | MKYSGLYFISNPSTNIDASLSIVNTLIQSIESSFQSATRQAPWSLSYRAFRDTIPPGYQHPTGADGKPKPYAHSYQHLLHLSNLDSNRTYIYAQPATQPETVVSIPLRQQDAYGSIGELRATREGPQSASVLSPGIVVCITTTVGAEDTDDGPDSGHASVGNETTMQVDGDDDEIDFEYAQTVIREFWSKIKDGRDLGRSEVREVMMAPVAPRKKAQERDAAVRRV |
| Length | 226 |
| Position | Head |
| Organism | Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Pyrenophora. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.546 |
| Instability index | 37.45 |
| Isoelectric point | 5.23 |
| Molecular weight | 24880.28 |
| Publications | PubMed=23316438 |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP24950
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.50| 21| 21| 150| 170| 1
---------------------------------------------------------------------------
150- 170 (39.07/22.03) DDGPDSGHA.SVGNETTMQV.DG
172- 194 (25.43/12.32) DDEIDFEYAqTVIREFWSKIkDG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) MKYSGLYFI 2) RDAAVR 3) RTYIYA 4) SYRAFRDTIPPGYQH | 1 219 88 46 | 9 224 93 60 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab