<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24950
| Description |
Uncharacterized protein |
| Sequence | MKYSGLYFISNPSTNIDASLSIVNTLIQSIESSFQSATRQAPWSLSYRAFRDTIPPGYQHPTGADGKPKPYAHSYQHLLHLSNLDSNRTYIYAQPATQPETVVSIPLRQQDAYGSIGELRATREGPQSASVLSPGIVVCITTTVGAEDTDDGPDSGHASVGNETTMQVDGDDDEIDFEYAQTVIREFWSKIKDGRDLGRSEVREVMMAPVAPRKKAQERDAAVRRV |
| Length | 226 |
| Position | Head |
| Organism | Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae>
Pyrenophora.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.546 |
| Instability index | 37.45 |
| Isoelectric point | 5.23 |
| Molecular weight | 24880.28 |
| Publications | PubMed=23316438
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24950
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.50| 21| 21| 150| 170| 1
---------------------------------------------------------------------------
150- 170 (39.07/22.03) DDGPDSGHA.SVGNETTMQV.DG
172- 194 (25.43/12.32) DDEIDFEYAqTVIREFWSKIkDG
---------------------------------------------------------------------------
|