Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MADPQPPPDDEDLILSFFPDPPPFYKHFTTENVKRLKEIEEEATSDNDDTKTSSTTKLTTEQILALPTELRYLIPPEPPGDDDEFHVFDVVTKAKGTNVFMKNMEYIAHNLALEGVFTDWTYEQLYPSGDAGTGAGDTDPSSPQQQPTTTTNSATLDRQNYLFRFLRSILLNYISLLGIVASNPTSDAKEQKLKDIMTMVANMHALINEYRPHQARHTLIERMEEQVRRKREEVEGVRRMGEQVREVLSGFGAVDGEDKSVVREVEVQDGALREEEARRDAFRGMWEAADEVVV |
Length | 294 |
Position | Middle |
Organism | Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Pyrenophora. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.657 |
Instability index | 50.79 |
Isoelectric point | 4.64 |
Molecular weight | 33353.79 |
Publications | PubMed=23316438 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP24944 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 91.76| 28| 48| 220| 247| 2 --------------------------------------------------------------------------- 220- 247 (45.40/28.60) IERMEEQVRRKREEVEGVRRMGEQVREV 265- 292 (46.36/29.34) VEVQDGALREEEARRDAFRGMWEAADEV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PDDEDLILSFFPDPPPFYKHFTTENVKRLKEI 2) TELRYLIP | 8 68 | 39 75 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab