<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24941
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MPPPIPPPDEQEFDQPQIIAGLLHPDLHAGNNVFWYFTSSPWFEAECLNINVWLNVRQNDPATAEQIMNDRKLWQQRLDDQPIGTQYVLAGEGQGEGHPWLLQRQNKVSVIKDDKEQIETFVEGNYYTHETKMLMAPSLLDIIQSRLNMTHWTPATGYSYFPPSYEAAKAATTASRVGSPTLAPTDLDGAVPQSQAAGAAAAVTTAQTTEPTASATEFSDMLFLQSLNLTNAYGDEYMDENPLKGEPGAFVFEGTKTAVSARNKAQEQAAQATQQLPPAAALKIDTQTASALPSAAPTPKGGATPGAAPGTPGSKGSVGPAPKKKKDRRKSQGGLTSPTTPSVPQ |
| Length | 345 |
| Position | Head |
| Organism | Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae>
Pyrenophora.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.539 |
| Instability index | 49.87 |
| Isoelectric point | 5.04 |
| Molecular weight | 37011.85 |
| Publications | PubMed=23316438
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24941
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 112.26| 26| 29| 162| 188| 1
---------------------------------------------------------------------------
162- 187 (46.99/20.89) PPSYEA.AKAAT.TASRVGSPTLAPTDL
192- 218 (37.72/15.66) PQSQAAgAAAAV.TTAQTTEPTASATEF
277- 298 (27.56/ 8.29) PPA.AA.LKIDTqTASAL..PSAAPT..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.99| 15| 79| 143| 161| 2
---------------------------------------------------------------------------
143- 161 (20.57/28.47) IQSrLNMTHwtpATGYSYF
224- 238 (28.42/18.11) LQS.LNLTN...AYGDEYM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.22| 12| 29| 301| 312| 4
---------------------------------------------------------------------------
301- 312 (23.92/10.84) GGATPGAAPGTP
333- 344 (23.30/10.38) GGLTSPTTPSVP
---------------------------------------------------------------------------
|