<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24922
Description |
Mediator complex subunit 30 |
Sequence | MSTPPLSGPGMGAAAGPGGFPGAQAATAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTVTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLVPYVEEEYSKHDDRGIASQLRFASEEKREILEVNKKLKQKNQQLKQIMDQLRNLIWDINSMLAMRN |
Length | 184 |
Position | Head |
Organism | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.444 |
Instability index | 46.03 |
Isoelectric point | 8.44 |
Molecular weight | 20856.77 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24922
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.25| 21| 73| 81| 101| 1
---------------------------------------------------------------------------
81- 101 (35.37/25.16) KLQEHLRQLSILFRKLR.LVYD
154- 175 (32.88/22.94) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|