<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24917
Description |
Thyroid hormone receptor-associated protein TRAP100 |
Sequence | MFCNSFELILSVATVQGKLKTFISGLIKCNEASKQIPGEMGKVALARAALFDVSFLMLSFIVQSYGSEVVLAENGDSFFEKWVRECLVEKHKSKSPAVMVKLCDQNKVDELIVSLNSPEGLKGSSLKWHEICANIPGLLYQVLMAWENETLSTPEIKKFLDSLKSRFCCFSVCATSWLCAYMQVVRQDELLKPMNMVQQFLTAVSADELMQQENFKERLGLTVQIVRKMQQTSNVCRGRVQTSNHAAISELSLANPLETVRGVWRRVGRVGCRSIDAGTGDLLHLADVWL |
Length | 290 |
Position | Tail |
Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Culicini> Culex> Culex.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.074 |
Instability index | 29.50 |
Isoelectric point | 7.97 |
Molecular weight | 32436.49 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24917
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.81| 16| 17| 181| 196| 1
---------------------------------------------------------------------------
181- 196 (28.97/24.64) YMQVVRQDELLKPMNM
200- 215 (26.84/22.30) FLTAVSADELMQQENF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.70| 18| 34| 115| 132| 2
---------------------------------------------------------------------------
115- 132 (34.80/16.72) LNSPEGLK.GSSLKWHEIC
151- 169 (28.90/13.07) LSTPEIKKfLDSLKSRFCC
---------------------------------------------------------------------------
|