<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24916
| Description |
"Mediator complex, 100kD-subunit" |
| Sequence | MTKLSEIVDPFSRVLAKLCVYCIVATMEAPTGPLSKKRSRAAIDGDDLLADGLCPTPKMRKMGSDSCDSSSSDFMLEHAAAAAAAVAFATKEAASGGVSLREPLQGCLQTLFRTFAQYIVSDELSPKIYFMFQFLTLLVEVGRERVKPVLKLIPNGLVQSMLKINATDDMTVGFILRLYDLNATTGRTFAMSDLCLFRNIQMRKDSIKL |
| Length | 209 |
| Position | Tail |
| Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Culicini> Culex> Culex.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.165 |
| Instability index | 40.53 |
| Isoelectric point | 8.52 |
| Molecular weight | 22918.64 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24916
No repeats found
|