<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24914

Description Mediator complex subunit rgr-1
SequenceMRGPQSTCDPSLRFTARLTPPSGSNPATPHLQSMGKGGSQNRLNFNMTSPPDAHMPHPSPSGLMPSSLLNPQPSPIGHLPGPTNMPYMDGQSDTDGSPFTTAHSPAAFNWPGSREMLQPSLRPGQSPNHKAQAPLHNTSRVLPAASAGHLYLSGPDALAEVYNCLHFFLAGEMVRSETPDWEM
Length183
PositionTail
OrganismCulex quinquefasciatus (Southern house mosquito) (Culex pungens)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Culicinae> Culicini> Culex> Culex.
Aromaticity0.06
Grand average of hydropathy-0.610
Instability index74.72
Isoelectric point6.48
Molecular weight19570.73
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP24914
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.52|      19|      22|      46|      67|       1
---------------------------------------------------------------------------
   46-   64 (37.15/14.63)	NMTSPPDAHMPHPSPSGLM
   70-   88 (37.37/ 9.65)	NPQPSPIGHLPGPTNMPYM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     100.28|      28|     106|       3|      33|       2
---------------------------------------------------------------------------
    3-   33 (48.61/23.61)	GPQSTCDPSLRFTarlTPPSGSNPATPHLQS
  112-  139 (51.67/20.07)	GSREMLQPSLRPG...QSPNHKAQAPLHNTS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24914 with Med14 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MRGPQSTCDPSLRFTARLTPPSGSNPATPHLQSMGKGGSQNRLNFNMTSPPDAHMPHPSPSGLMPSSLLNPQPSPIGHLPGPTNMPYMDGQSDTDGSPFTTAHSPAAFNWPGSREMLQPSLRPGQSPNHKAQAPLHNTSR
1
140










Molecular Recognition Features






MoRF SequenceStartStop




NANANA