<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24906
| Description |
Mediator complex subunit rgr-1 |
| Sequence | MPYMGGQSHTDGSPFTVSHSPAASNWPGSPGMPRPSSRPCQNPDHKAKSEYFLLLHTTKLPAFWQLQLQANYIHQLIHGRIVDSPDALAEVYNCLHYFSRDATCKLNSTLQLLCDKVLEMHVTALLDAAPKFLRNRLKDVLQGTLIEVEPGVLLMFHDPDKA |
| Length | 162 |
| Position | Tail |
| Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Culicini> Culex> Culex.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.275 |
| Instability index | 61.90 |
| Isoelectric point | 6.74 |
| Molecular weight | 18118.60 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24906
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.22| 27| 43| 38| 66| 1
---------------------------------------------------------------------------
38- 66 (48.09/32.66) RPCQNPDhkAKSEYFLLLH......TTKLPAFWQL
80- 112 (43.12/23.42) RIVDSPD..ALAEVYNCLHyfsrdaTCKLNSTLQL
---------------------------------------------------------------------------
|