Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MLYPEDDLITYDALNSASDSSEDESSYEDLLDRCDGADSASYLVNEFFARDQSGNREETNNASEPRASGFKPRSVSKRKDIENKKQGARRRGSRAGTRNLEPERGDKRESDEYDEEPFRKLLVPLALPGWLQTQQLIWESGSLCQLLHRRRNVTANNRMPNSNETKSMNSAQQQKQQITNAMKNFSIRTLAELGHRIRCWSRRRSSRASMQLAVDRISAGQTEGRPVACGDQQWQSRRILKAKEEWDTEASSRPGIQQTSSLADTQALVAAVGLGNGLTLPMGPGGVPNPGLMIPPAIRQASPISAVSPGAGMGKMPSGIKTNIKSANQVHPYRFQDF |
Length | 338 |
Position | Head |
Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Culicinae> Culicini> Culex> Culex. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.843 |
Instability index | 63.17 |
Isoelectric point | 9.15 |
Molecular weight | 37494.39 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP24905 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.95| 20| 21| 50| 69| 1 --------------------------------------------------------------------------- 50- 69 (33.57/17.77) RDQSGNREETNNASEPRASG 73- 92 (32.38/16.92) RSVSKRKDIENKKQGARRRG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.15| 14| 21| 5| 18| 3 --------------------------------------------------------------------------- 5- 18 (24.45/19.08) EDDLITYDALNSAS 28- 41 (25.70/20.44) EDLLDRCDGADSAS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EDESSYEDLLDRCDGADSASYLVNEFFAR 2) MLYPEDDLITYDALNSASD | 22 1 | 50 19 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab