<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24904
Description |
"Mediator complex, subunit, putative" |
Sequence | MSLFRFNQLFELGLIFFGDVCVPSSMFNRSLTPNPSLFSPEYIVIDGGYSTHLSKQVSQTMLGREVADTTQPTRTRWRQTRPEINQLQKQLKEAEYILATSIFQARQKLTSFAKATKRPVLSDELIKETSAGHTRRTEMRLGFLCNSAINGHQNPASQNNPGEINRTGAAGGSEITPGGFGGIGEITVSAQNQFAWHLSVELHMTMGGGSSIPLDTRAGGQDDVEVMSTDSSSSSSSDSQ |
Length | 240 |
Position | Middle |
Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Culicini> Culex> Culex.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.420 |
Instability index | 48.54 |
Isoelectric point | 6.21 |
Molecular weight | 26166.94 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24904
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.10| 24| 143| 49| 76| 1
---------------------------------------------------------------------------
49- 76 (37.58/30.02) YSTHLSKQVSQTMLGrevaDTTQPTRTR
194- 217 (45.52/27.01) FAWHLSVELHMTMGG....GSSIPLDTR
---------------------------------------------------------------------------
|