Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MRGFFKDSAFINYLKYLLYWKDPEYAKYLKYPMCLYFLDLLQYEHFRREIVNAQCCKFIDDQAILLWQHYTRRRTRLTSLGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIAALTAASNNNNNNTVNTNANNPGGGGQPGGQSGGGPGQQQNGGPIAQQNGLGNSTGMAGMVLGGGGGGGGSGGINLSGQKVS |
Length | 192 |
Position | Middle |
Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Culicinae> Culicini> Culex> Culex. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.361 |
Instability index | 38.64 |
Isoelectric point | 9.19 |
Molecular weight | 20139.32 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP24903 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 126.98| 36| 37| 108| 144| 1 --------------------------------------------------------------------------- 108- 144 (63.07/25.76) PAIAALTA..ASNNNNNNTVNTNANNPGGGGQPGGqSGG 146- 183 (63.90/23.26) PGQQQNGGpiAQQNGLGNSTGMAGMVLGGGGGGGG.SGG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 88.52| 18| 45| 10| 27| 2 --------------------------------------------------------------------------- 10- 27 (33.45/25.29) FINYLKYLLYWKDPEYAK 37- 54 (28.32/20.50) FLDLLQYEHFRREIVNAQ 58- 72 (26.74/19.02) FIDDQAILL.WQ..HYTR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AGMVL 2) SGGINLSGQKVS | 168 181 | 172 192 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab