<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24893
Description |
"Mediator complex, 95kD-subunit, putative" |
Sequence | MLVKKKADVEARSKQVLMTKNQRAAEALKKGQEEAANETPGLVANLDLGPLGVGVGHRQGAPKPCGQKHYHGGLIAEKQQPIQGIADLALNISQTTQNMHFGVQQAGLRHQQGLRRTPHYPRTAGYLRIWRLPVYSRSTDNLNISVTLISLITKLALNPNDILLDEYCLLSNQVRIPPLRFVPSRTMLDLPLLPYISLLVICSSPFSDAKMSAEAFEGKIGQVISELKIRDRVQQEGI |
Length | 238 |
Position | Tail |
Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Culicini> Culex> Culex.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.245 |
Instability index | 48.74 |
Isoelectric point | 9.59 |
Molecular weight | 26300.21 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24893
No repeats found
No repeats found
|