<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24890
Description |
Uncharacterized protein |
Sequence | MASLAAGSRNDFALHRKQITDLCGIKWRKLAQGERPNASSNPLDDPVLRSYSKCLEVDILCVWRRVAAPKPAEQDPNVFEMSIPGPVTGGSVIHPPLSLTAAKELWIFWYGEEPDLTDLVDPELLKSAVTVASK |
Length | 134 |
Position | Middle |
Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Culicini> Culex> Culex.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.183 |
Instability index | 40.49 |
Isoelectric point | 5.66 |
Molecular weight | 14724.74 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24890
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.69| 14| 33| 27| 42| 1
---------------------------------------------------------------------------
27- 42 (18.62/19.56) WRKLAqGERPnASSNP
63- 76 (28.07/17.02) WRRVA.APKP.AEQDP
---------------------------------------------------------------------------
|