| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MTGVEYILLHVQDPILYVIRKQHRHTPTEATPLADYYIIAGTVYQAPDLASVFNSRMLSTVHHLQSAFEESSSFARYHPSKGYSWDFSSNKAIAENNKTDKSKEVAAKEEPSSLFQRQRVDMLLGDLLRKFPLPIPQAYQHGSGQQQQNQNGSSAANNNSGGGGGDGGDHGSEVASIKQEPGEHGSNDMGGSLLMQGIKEEGGSDMKPPPEKKMKMKFRKAVQQ |
| Length | 224 |
| Position | Head |
| Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Culicinae> Culicini> Culex> Culex. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.760 |
| Instability index | 46.51 |
| Isoelectric point | 6.76 |
| Molecular weight | 24589.14 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP24883
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.51| 23| 27| 140| 162| 1
---------------------------------------------------------------------------
140- 162 (41.50/23.59) QHGSGQQQQNQNGSSAANNNSGG
169- 191 (42.01/23.96) DHGSEVASIKQEPGEHGSNDMGG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KPPPEKKMKMKFRKAVQQ 2) SIKQEPGEH 3) SLLMQGIKE | 207 176 192 | 224 184 200 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab