<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24881
Description |
Mediator complex subunit rgr-1 |
Sequence | MNVAPDAHMPHPSPSGLMPSSLLNPQPSPIAHLPGPTNMPYMDGQSDTDGSPFTTAHSPAASNWSGSREMLRPSLRPGHYVQSEPQGAGSQIGTRLNIQLYRHSNVILIVEPNEKESSPNEMTYTLYLVLVKPSSVENSQPQDAEPSITSSVSQSGPGSVPPGCVLSVPELSSSAAHPPTSSSTTENDGMPKLYLKVQSLIEFDTFVAMHDPGTYVNELAGSKRKLGALGEGPSKQQKSWPTPWSHCNEKLPLANELTLRRIPHGGLQVEANGTIMAVMKINEQEKIDHPVSIDCLSTEVDSPAKL |
Length | 306 |
Position | Tail |
Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Culicini> Culex> Culex.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.482 |
Instability index | 68.95 |
Isoelectric point | 5.52 |
Molecular weight | 32822.51 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP24881
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.09| 12| 24| 27| 38| 1
---------------------------------------------------------------------------
27- 38 (24.76/10.32) PSPIAHLPGPTN
52- 63 (22.34/ 8.66) PFTTAHSPAASN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.99| 13| 14| 134| 146| 3
---------------------------------------------------------------------------
134- 146 (22.98/ 9.09) SSVENSQPQDAEP
150- 162 (23.00/ 9.11) SSVSQSGPGSVPP
---------------------------------------------------------------------------
|