<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24876
| Description |
Transcription elongation factor S-II |
| Sequence | MLSNIKQALDLLRQLQRLSIDLDILTKTRIGMTVNELRKCSKDDEVINLAKTLIKSWKRFLAATTSSKDSSKSSSKTSSSSSKSSASGGSSTSHSGRHDHSKRDHHRKERDDKKRARSRSPQRASNTTDTVRLKCREMLAHALQVEGEQPEGCQPPEELGEELEEAIFAEIKNTDFRYKNRVRSRVANLKDPKNPSLRANFVSGAITAERLAKMTPEEMASDEMKNLRDRFVKEAINDAQLATNQGTKTDLLKCGKCKKRNCTYNQLQTRSADEPMTTFVLCNECGNRWKFC |
| Length | 292 |
| Position | Unknown |
| Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Culicini> Culex> Culex.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.916 |
| Instability index | 50.65 |
| Isoelectric point | 9.54 |
| Molecular weight | 32984.98 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24876
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.82| 24| 27| 197| 222| 1
---------------------------------------------------------------------------
197- 222 (35.83/35.49) LRANFVSGAITAERLAkmTPEEMASD
227- 250 (40.99/32.15) LRDRFVKEAINDAQLA..TNQGTKTD
---------------------------------------------------------------------------
|