<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24872
| Description |
"Mediator complex, subunit, putative" |
| Sequence | MASSSNVNGNLVDELEEAFQSCIHALTKEESATGIDKDEIKLEVDQTTLKFIDLARQMEAFFLQKRFLLSALKPDLLLKEENFDLRQEIARKDELIRKHYEKIESWKNLLSDQQNYNKPMQAHPVPPEMRSMAGGAPGPGGMMPGGMGMPMQVPSPTVAQWNQSSDLLEDYLCPRVTPGSAGC |
| Length | 183 |
| Position | Head |
| Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Culicini> Culex> Culex.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.498 |
| Instability index | 53.95 |
| Isoelectric point | 4.93 |
| Molecular weight | 20440.13 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24872
No repeats found
No repeats found
|