<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24871

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMRIISVLLVDRETGSRRNDPPRKPTFPRKVPRLLPSNFGTAKAQKEPPRNNGVPRRKYRKHSTTRNRFRVWWDHNRRIHTPQTHNKSVRRKKTVLQLVELLVSKDKEMKSTLQLAADQAGIERKLDGLRDQVRDQDKEINQLQKQLKEAEYILATSIFQARQKLTSFAKATKRPVLSDELIKFAHRKIASNAICAPLTWQQGDQRQPYPTDRDAAGLPLQFRHQRAPECGQPEQSRRN
Length238
PositionMiddle
OrganismCulex quinquefasciatus (Southern house mosquito) (Culex pungens)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Culicinae> Culicini> Culex> Culex.
Aromaticity0.05
Grand average of hydropathy-1.057
Instability index53.30
Isoelectric point10.95
Molecular weight27759.49
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats
>MDP24871
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.12|      16|     125|      41|      81|       1
---------------------------------------------------------------------------
   17-   32 (31.99/11.66)	RNDPPRKPTFPRKVPR
   44-   59 (31.13/38.03)	QKEPPRNNGVPRRKYR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.87|      15|      21|     191|     207|       2
---------------------------------------------------------------------------
  191-  207 (25.70/17.73)	NAICAPLTWQQgdQRQP
  213-  227 (28.17/13.38)	DAAGLPLQFRH..QRAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      27.81|       9|      28|     104|     113|       3
---------------------------------------------------------------------------
  104-  113 (11.61/14.76)	KDKEMkSTLQ
  135-  143 (16.20/13.02)	QDKEI.NQLQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP24871 with Med4 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) VDRETGSRRNDPPRKPTFPRKVPRLLPSNFGTAKAQKEPPRNNGVPRRKYRK
2) WQQGDQRQPYPTDRDAAGLPLQFRHQRAPECGQPEQSRRN
9
199
60
238










Molecular Recognition Features






MoRF SequenceStartStop




1) RRKYRKH
55
61