<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24868
| Description |
Mediator complex subunit rgr-1 |
| Sequence | MEALLRRNTRQPLPTGPEHRECRGHHHDLIKVETTRCRSARVLPAVSAGQSLATATSLFQTTLLDHTTKVAIFAGNDAGAIATGVSPGDAIEKVGQHKIYIQLYRHSSVIFIVEGEGLQPERDDVHVLPGACQAVLRRGQPITGRVTLDTLLGEPICPGLCSSRKTTQQRSRTVLVKRHRERPRTQNEPQHAIAVRETFGVTHGPGMYVEELGGSKHKLSALSEGPSKQQKVLYPAYFNPVLAHVVAMCEAAVCGIGEETYAPSDSSRWSAGESERHFVGAETVDLASAEGTTGILPPDLFKTCPGQPSVGVPANWTIGR |
| Length | 320 |
| Position | Tail |
| Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Culicini> Culex> Culex.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.321 |
| Instability index | 47.65 |
| Isoelectric point | 8.42 |
| Molecular weight | 34579.85 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24868
No repeats found
|