<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24864
| Description |
"Mediator complex, subunit, putative" |
| Sequence | MQRNITQSKEALLKSYNTRLKEDVRSMLENFEEIVRLAKGENETQLSKMTQCEQDTYEMQVRASNIVRAGESLMKLVSDIKQYLILNDFHSVNDAICSSSQLYRSTQMDRDNKLMMVRDDMAADLYDLEEEYYTSMYK |
| Length | 138 |
| Position | Head |
| Organism | Culex quinquefasciatus (Southern house mosquito) (Culex pungens) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Culicini> Culex> Culex.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.703 |
| Instability index | 39.16 |
| Isoelectric point | 4.87 |
| Molecular weight | 16251.23 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24864
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.96| 18| 55| 45| 62| 1
---------------------------------------------------------------------------
45- 62 (33.77/19.60) QLSKMTQCEQDTYEMQVR
101- 118 (33.19/19.16) QLYRSTQMDRDNKLMMVR
---------------------------------------------------------------------------
|