<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24858
| Description |
Predicted protein |
| Sequence | MLQTEGNVTLPMVMSLLCSYRGLFIDACKSCGRVVSSEGYTPPVVRVWRGDWEARHGSCF |
| Length | 60 |
| Position | Tail |
| Organism | Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Tricholomataceae> Laccaria.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | 0.087 |
| Instability index | 48.96 |
| Isoelectric point | 7.68 |
| Molecular weight | 6697.72 |
| Publications | PubMed=18322534
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24858
No repeats found
No repeats found
|