Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVKPKAKRKEEPSSIFQRQRVDALLIDLRQKFPPRFVQQKSGEKPVPVDQAKKEAEPLPETVKSEEKESAKSAQQTVSTKGPPEKRMRLQ |
Length | 246 |
Position | Head |
Organism | Rattus norvegicus (Rat) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Rattus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.571 |
Instability index | 52.37 |
Isoelectric point | 8.71 |
Molecular weight | 28320.04 |
Publications | PubMed=15489334 PubMed=15057822 PubMed=15632090 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 ISO:RGD nucleoplasm GO:0005654 IEA:Ensembl nucleus GO:0005634 ISO:RGD ubiquitin ligase complex GO:0000151 IDA:RGD |
GO - Biological Function | DNA binding GO:0003677 ISO:RGD transcription coactivator activity GO:0003713 ISO:RGD transcription factor binding GO:0008134 ISO:RGD |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 ISO:RGD protein ubiquitination GO:0016567 IDA:RGD regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central stem cell population maintenance GO:0019827 ISO:RGD |
Binary Interactions |
Repeats | >MDP24842 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.02| 21| 42| 148| 168| 1 --------------------------------------------------------------------------- 148- 168 (37.33/21.99) HFKDHEEQDKVKP..KAKRKEEP 191- 213 (31.69/17.76) RFVQQKSGEKPVPvdQAKKEAEP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PVDQAKKEAEPLPETVKSEEKESAKSAQQTVSTKGPPEKRMRLQ 2) RVDALLIDLRQKFPPRFVQ | 203 176 | 246 194 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab