<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24831
| Description |
Predicted protein |
| Sequence | MDHLVQNLQNAYQALISAASDVLDAKGTADLARTAKTDAALEQFYNNLQLFHAACDQTQEFVEYLQLRIGSECLVDEATGSVTAKVGKPGQDAADNRVAIPSLSALRLEQMSKAVRWLVIELQQGATAGDNSAAMDIRTEDDANQ |
| Length | 145 |
| Position | Tail |
| Organism | Physcomitrella patens subsp. patens (Moss) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Bryophyta>
Bryophytina> Bryopsida> Funariidae> Funariales> Funariaceae> Physcomitrium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.247 |
| Instability index | 46.19 |
| Isoelectric point | 4.43 |
| Molecular weight | 15654.24 |
| Publications | PubMed=18079367
PubMed=29237241
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblPlants
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:EnsemblPlants
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
response to hydrogen peroxide GO:0042542 IEA:EnsemblPlants
root development GO:0048364 IEA:EnsemblPlants
|
Interaction
Repeat regions
| Repeats |
>MDP24831
No repeats found
|