<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24830
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MTVKWLYYWQPSIGVTMSSQTLSIAIKRIEALHGVKTSRWQITASQFRPNQREPVPLVECARELLGVVFSEVPDKYYFALRQEHMVVEADATMQAIMEKLQVYRNRLTILFEGFQYELGDFHIKAGRAVLAHTENLRGIVLEVDYKPLSSVEQSRRVVQDFMEVWQKGETTGQFVPLDPNFSEFNLPDLYSWQHTALQYVTLMAFVFSQQRT |
Length | 212 |
Position | Head |
Organism | Physcomitrella patens subsp. patens (Moss) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Bryophyta>
Bryophytina> Bryopsida> Funariidae> Funariales> Funariaceae> Physcomitrium.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.186 |
Instability index | 42.56 |
Isoelectric point | 6.22 |
Molecular weight | 24688.05 |
Publications | PubMed=18079367
PubMed=29237241
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP24830
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.30| 11| 28| 165| 177| 1
---------------------------------------------------------------------------
165- 177 (18.08/18.96) WQkgETTGQFVPL
192- 202 (22.23/14.71) WQ..HTALQYVTL
---------------------------------------------------------------------------
|