<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24810
| Description |
Protein CBR-MDT-9 |
| Sequence | MSSTSKEANKPSAESYLNKLYADLYHLVNSVEKGSGSELTVRLRNVESDIANFKEAIKTLPDISVGEGKQRGQISALYKQIEKKDELLESLAAFSLDARTNEDTLICKECKTVVILKNMTTEFLNEERDLPLPRQKKGIDHTQTEPVRGYFGVKDIFAFENVGFTRSSEGKRYLVCGECEQGPVGFVDTLTEMNYVTPERLAVQQTTNSPVEN |
| Length | 213 |
| Position | Middle |
| Organism | Caenorhabditis briggsae |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.529 |
| Instability index | 40.20 |
| Isoelectric point | 5.18 |
| Molecular weight | 23852.61 |
| Publications | PubMed=14624247
|
Function
| Annotated function |
|
| GO - Cellular Component | cytosol GO:0005829 IBA:GO_Central
membrane GO:0016020 IBA:GO_Central
|
| GO - Biological Function | guanyl-nucleotide exchange factor activity GO:0005085 IBA:GO_Central
zinc ion binding GO:0008270 IBA:GO_Central
|
| GO - Biological Process | post-Golgi vesicle-mediated transport GO:0006892 IBA:GO_Central
protein transport GO:0015031 IEA:UniProtKB-KW
small GTPase mediated signal transduction GO:0007264 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP24810
No repeats found
|