<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24805
| Description |
Uncharacterized protein |
| Sequence | MGSITELEDSLNMLLKVMASAIAYLSRKSGHTPVNAQVPLTVLGNTEALPPETLEASRDELVQDLISQAKDVQRRIDALPSRDISEDEHVRGCCLVTLLIRIGQCRTDAFGS |
| Length | 112 |
| Position | Middle |
| Organism | Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Malasseziomycetes> Malasseziales> Malasseziaceae> Malassezia.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.075 |
| Instability index | 41.39 |
| Isoelectric point | 4.89 |
| Molecular weight | 12204.83 |
| Publications | PubMed=18000048
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24805
No repeats found
No repeats found
|