<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24803
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MARGSVLAAGTATQYVETPVRPHSSRVRIMLHTATGATELDPERVANQQRFSRDLEFLSALSNPYYLHQLSQQGYFEDEAFLHYLEYLDYFRAPRYVKYLTYPQSLYFLDLLKHEAFRSAVADSAWPHDTAARQMAHWATWRDPVNVSFGSPPRE |
Length | 155 |
Position | Middle |
Organism | Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Malasseziomycetes> Malasseziales> Malasseziaceae> Malassezia.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.477 |
Instability index | 34.21 |
Isoelectric point | 6.37 |
Molecular weight | 17945.86 |
Publications | PubMed=18000048
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP24803
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.88| 24| 29| 55| 82| 1
---------------------------------------------------------------------------
55- 78 (44.83/31.31) LEFLSALSNPYYLHQLS..QQGYFED
85- 110 (40.04/18.77) LEYLDYFRAPRYVKYLTypQSLYFLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.75| 21| 103| 22| 45| 2
---------------------------------------------------------------------------
22- 45 (34.20/27.62) PHSSRVRIMLHTATGAtelDPERV
127- 147 (43.55/27.11) PHDTAARQMAHWATWR...DPVNV
---------------------------------------------------------------------------
|