<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP24800
| Description |
Uncharacterized protein |
| Sequence | MWHVTDSAWPNHVFVVFEDTSKPTRAGADAPAEAASATPGLRRWHAHVLSAEIHTLLRQSSLPGPLGSPAGTPGPGAWIQRGAQVLLDGFSFRVKLGAHSQMRRGALDAVGEQEECILSIGNVIVGSDRIAGGIVEIQYLPLTRLAPDSTLLGSILTMLLPPDIVHLLVPPSAPPMPLSLPTMALPTMISPTQLAEIVPASGTSSSASFTPGAPGFDPWEDEVNTDSIGWSGVEMRRRMAYVHLVMLRAEGLA |
| Length | 253 |
| Position | Head |
| Organism | Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Malasseziomycetes> Malasseziales> Malasseziaceae> Malassezia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.109 |
| Instability index | 52.53 |
| Isoelectric point | 5.55 |
| Molecular weight | 26825.49 |
| Publications | PubMed=18000048
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP24800
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.20| 24| 26| 147| 172| 1
---------------------------------------------------------------------------
147- 172 (39.86/23.14) PDSTLlgSILTMLLP....PDIVHLLVPPS
174- 201 (40.34/18.34) PPMPL..SLPTMALPtmisPTQLAEIVPAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 107.44| 30| 32| 38| 67| 2
---------------------------------------------------------------------------
9- 27 (27.58/11.49) ......W...PNHVF.............VVFEDTSKPTRAG
38- 67 (56.11/29.69) TPGLRRW...HAHVL....SAEI....HTLLRQSSLPGPLG
72- 107 (23.75/ 9.05) TPGPGAWiqrGAQVLldgfSFRVklgaHSQMRRGAL.....
---------------------------------------------------------------------------
|